🔙
Advertisement:

Buscar hojas

Are you bilingual and want to help translate some sheets? Shoot me a message: CCSadmin@commoncoresheets.com
¿Eres bilingüe y quieres ayudar a traducir algunas hojas? Envíeme un mensaje: CCSadmin@commoncoresheets.com
buscar: categoría: Grado:
Spelling Add or Remove Created By Grade Created on Title Words Wednesday Jun 16, 2021
cagecentscoldedgeforesthandshedgehoglancemicemittennicepledgepuffedracedslicesspacestagetracewide
Load
Wednesday Jun 16, 2021
companydefinitelydesperatedifferenceenvironmentexplanatoryjewellerypoisonoussecretaryvoluntary
Load
Emma Wednesday Jun 16, 2021 domains 2
A) 3 Domains of the Classification SystemB) ProkaryotesC) EukaryotesD) The 4 Kingdoms of Domain Eukarya E) Archaea and BacteriaF) EukaryaG) contain a nucleusH) lack a nucleusI) Archaea, Bacteria and EukaryaJ) Plants, Animals, Protists and Fungi
Load
Tia Wednesday Jun 16, 2021
JanSamamanbadbagcancatdadgashatjammadmanmapmatnapratsadsattagtantheyam
Load
Spelling list #1
Wednesday Jun 16, 2021
blue boybrowncolorfloorgirlgreenhatorangepinkpurplered she skyspoonyellow
Load
Lena K Wednesday Jun 16, 2021 Domains
A) 3 Domains of the Classification SystemB) ProkaryotesC) EukaryotesD) 4 Kingdoms of Domain Eukarya E) Archaea and BacteriaF) EukaryaG) contain a nucleusH) lack a nucleusI) Archaea, Bacteria and EukaryaJ) Plants, Animals, Protists and Fungi
Load
Wednesday Jun 16, 2021 suffix less and ly
hopeless badlycarelessfearlesshappilyjoylesslovelypennilessquickly slowly
Load
J. Cooper Wednesday Jun 16, 2021 MS 1,2,3
adversaryapprehensiveattentivebarricadecontortioncunningdebriseavesdropegregioushabitationimperiousmeticulouspersistentsabotagestamina
Load
MS 1,2,3
Wednesday Jun 16, 2021
eighteighteeneightyelevenfifteenfiftyfortyfourfourteenhundrednineteen ninetysevenseventeenseventysixteensixtythirteenthirtythreetwelvetwenty
Load
Wednesday Jun 16, 2021
eighteighteenelevenfifteenfiftyfivefortyfourfourteenninenineteenonesevenseventeenseventysixsixteensixtytenthirteenthirtythreetwelvetwentytwo
Load
Wednesday Jun 16, 2021
eightfivefournineonesevensixtenthreetwo
Load
Tuesday Jun 15, 2021
EnglishJapanesedeadgearkickkittenlootmakemarkmatepopreckonroofshetauntteetoadtraitor
Load
Incognito Tuesday Jun 15, 2021 U1w1
affordbatchdockdoveflingguessguessgushjutlaughleadloannicknotchprofitprosperroughscanscan scarceshrugstumptenthtoughwatch
Load
Ms. Lopez Tuesday Jun 15, 2021 Fun
AaronChavezDavidEliasErikEthanGenaroJakeKevin Ms.DiazMs.LopezMs.MartinezMs.PikoszPedroSergio
Load
THel Tuesday Jun 15, 2021 1st grade HMH
dustdustyhelphelpfulhopehopefuljumpedmailedstayingtricktrickywarmwarmlywishing
Load
yay Tuesday Jun 15, 2021
chewcluecutegrewhugejuicerulesuittruetune
Load
u words
yday Tuesday Jun 15, 2021
ableaddalonecelebratechangedelicatedifferentemptyenormousfinishfoldfollowpreparetogetherwhisper
Load
u words
Victoria Turcios Tuesday Jun 15, 2021
ambulanceaquiredescendant disastrousespeciallyexcellenthangarinquireintermission leaguemarriage mechanicmuseum patientrequirementrural safetyscientificscissorsseparatestudio temperatureunbelievableviolencevoult
Load
FRANCISF Tuesday Jun 15, 2021 STD 4 SPELLING
Antarcticadhesiveappetiteapplaudartificialclassicalcutleryencouragefascinatehideousimmediateinvisiblelaughtermarvellousmaximumopinionorchardorchidornamentparticipatepedestrianpossessivepreparationresolvetransparent
Load
FFOSTER Tuesday Jun 15, 2021 STD 3 SPELLING
Easteracceptarticlebathebranchbrilliantchocolatecompanioncrescentdangerousenoughfamousglisteningknightloungemeasurepleasurepracticalprogrammeprotectionroaringshearershouldn'tsurprisetowels
Load
Brittany Hayes Tuesday Jun 15, 2021 Black-Footed Ferrets
black-footed ferretburrowscoyotesdomesticatedendangeredgrasshabitatprairie dogspredatorpreyshortgrass prairiewild
Load
Tuesday Jun 15, 2021
cerealcriteriaexperiencefiercemysteriousnearestpeerpierserialvolunteerweird
Load
D Price Tuesday Jun 15, 2021
aloof although either neighbor presentation receive release special tomorrow yesterday
Load
Roksana karolina Zaborowska Tuesday Jun 15, 2021
BATHROOMBECAUSECHICKENEYESFAVORITEFRIENDGIRAFFEHELPHOUSEKITCHENSCHOOLTEETHTHEWASHWATCHWITHYESTERDAY
Load
Roksana karolina Zaborowska Tuesday Jun 15, 2021 VERBS IN PAST
BECAMEBUILTCAMEFORGAVEGREWHELDHUNGKNEWLENTRANGRODESENTSPENTSPOKEWOKE
Load
Tuesday Jun 15, 2021 4G
aiydynnbraylenchaycefourth gradegabehenryjainaloganmayleemrs. giffordnatiliepaigeraylantristentruxton
Load
CommonCoreSheets Fan Tuesday Jun 15, 2021
alexbendanicaemilyhannaliammaddoxmadisonmaxinemilawilliam
Load
CommonCoreSheets Fan Tuesday Jun 15, 2021
aalexbabybedboybrotherfavouriteflagfoodgirlhannahardlaineliammadmynewnovembernumberreidsadsistervanwaterwilliam
Load
CommonCoreSheets Fan Tuesday Jun 15, 2021
;ratLovegymhannahappyjammapmilamomoldsadseesomeup
Load
Ms. Diaz Tuesday Jun 15, 2021
circumflexdeflectflexibleflexorfractalsfractionfracturefragilefragmentfragmentedfrailinflectioninflexibleinfractionreflectreflectionreflex anglerefractretroflexsuffrage
Load
Angel Shelley Tuesday Jun 15, 2021
churnedcroakedglisteninghorizonpanerattledsamovarscurriedstammeredsultry
Load
Kathy Curry 2020-202 Tuesday Jun 15, 2021
badgebridgedodgedrudgefridgefudgehedgelodgepledgewedge
Load
dge Practice
Christine Day Tuesday Jun 15, 2021
alsoanotherbecausecolorcouldfriendkindleavesurewhere
Load
Thonisha Davis Tuesday Jun 15, 2021
acute angleadditioncircumferencecomposite numberdecimaldivideequationequivlentinequalityline graphline plotmixed numbermultiplyobtuse angleparallelogrampatternsperimeterprime numberradiusreflectionrhombusright angleroundsubtractionvolume
Load
Thonisha Davis Tuesday Jun 15, 2021
acute angleadditioncircumferencecomposite numberdecimaldivideequationequivlentinequalityline graphline plotmixed numbermultiplyobtuse angleparallelogrampatternsperimeterprime numberradiusreflectionrhombusright angleroundsubtractionvolume
Load
Judy Tuesday Jun 15, 2021 Summer Words
baseballbasketballbeachflowersfrisbeemosquitooutpoolsandschoolshovelsparklerssunsunscreenswim
Load
CommonCoreSheets Fan Tuesday Jun 15, 2021
alwaysbecausebelongcomecomeeighthowevermineneverranreadrentsweetwentyour
Load
Teresa Allan Tuesday Jun 15, 2021
circumflexdeflectflexibleflexorfractalsfractionfracturefragilefragmentfragmentedfrailinflectioninflexibleinfractionreflectreflectionreflex anglerefractretroflexsuffrage
Load
Spelling June 15
Teresa Allan Tuesday Jun 15, 2021
circumflexdeflectflexibleflexorfractalsfractionfracturefragilefragmentfragmentedfrailinflectioninflexibleinfractionreflectreflectionreflex anglerefractretroflexsuffrage
Load
Teresa Allan Tuesday Jun 15, 2021
circumflexdeflectflexibleflexorfractalsfractionfracturefragilefragmentfragmentedfrailinflectioninflexibleinfractionreflectreflectionreflex anglerefractretroflexsuffrage
Load
Teresa Allan Tuesday Jun 15, 2021 June 15 - Spelling
circumflexdeflectflexibleflexorfractalsfractionfracturefragilefragmentfragmentedfrailinflectioninflexibleinfractionreflectreflectionreflex anglerefractretroflexsuffrage
Load
Spelling june 15
J Jimenez Monday Jun 14, 2021 Week 1 Spellings
DistributeExecuteFuriousGenuineHumorousOccupationPossiblePotatoesPurifyRidiculous
Load
Week 1 spellings
CommonCoreSheets Fan Monday Jun 14, 2021
becomedirtdoughflatflourjealousownsilentsprayvarnish
Load
Monday Jun 14, 2021
addictionbackingconcernconsciousnessdecadedemandingdetachedextremelyfamiliarizefortunefounderimpressiveinternallaunchpioneerpreciousreplaceresourcesustainventure
Load
Monday Jun 14, 2021
connoisseurequivalentgrammarintriguedjeopardiselicencemanoeuvreplacatereprimandsubtle
Load
Diana Monday Jun 14, 2021
airychaircheerdairydeerfairfairyflairhairhairyjeerlairpairpeerrepairsheersneerstairsteerveer
Load
AIR and EER words Adam
Diana Monday Jun 14, 2021
benchbranchcatchclutchditchfetchitchmatchmunchpatchpinchranchscratchsketchsnatchstitchswitchtwitchwatchwitch
Load
Adam
ff Monday Jun 14, 2021
althoughanniversaryapproacharrangeassignmentassistantastronautblanketscomplaintcouragecrusadecushiondisappearemployenablehandkerchiefmagnificentpotatoesproperlyrazorrefusereinssparklingsuburbtrespass
Load
andrea Torres Monday Jun 14, 2021
community centerdaydreamdo exercisedo volunteer workdreamfall asleepgated communityhave nightmareshomeless shelterjoin a clublook after someonemake friendsmentor someoneneighborhoodnursing homeraise moneyschool campussleep walksleepwalkslumsuburbtake partwake upyawn
Load
andrea Torres Monday Jun 14, 2021
community centerdaydreamdo exercisedo volunteer workdreamfall asleepgated communityhave nightmareshomeless shelterjoin a clublook after someonemake friendsmentor someoneneighborhoodnursing homeraise moneyschool campussleep walksleepwalkslumsuburbtake partwake upyawn
Load
andrea Torres Monday Jun 14, 2021
community centerdaydreamdo exercisedo volunteer workdreamfall asleepgated communityhave nightmareshomeless shelterjoin a clublook after someonemake friendsmentor someoneneighborhoodnursing homeraise moneyschool campussleep walksleepwalkslumsuburbtake partwake upyawn
Load
Foster Monday Jun 14, 2021
alterationanxiouslyaudibleawkwardbenefitconsciencecourageouscultivatedcuriositydessertdroughtenthusiasmexhaustedextinguishgeraniumharvesterimaginativeingredientsliliesnovitiatereliableserviettesuperiorviolinistweird
Load
Maureen Loutzenhiser Monday Jun 14, 2021
agreeaheadatticbeautifulcountriesdegreediagramdinnerdistrust equalimage perfectpianopilgrimplanet pleasingpracticepunishrefundrequestsamplescienceslammedsteadytoothbrush
Load
Maureen Loutzenhiser Monday Jun 14, 2021
anything believebladeblockbreakbuildcollectescapedfunniesthockeyjudgelaziestmailboxprairieprincipalrefresh skill slope tracktraveled waitwandering weaknesswestwinning
Load
Maureen Monday Jun 14, 2021
anything believebladeblockbreakbuildcollectescapedfunniesthockeyjudgelaziestmailboxprairieprincipalrefresh skill slope tracktraveled waitwandering weaknesswestwinning
Load
Stephanie Ortiz Monday Jun 14, 2021
free versegobbleimageryindividualitymetaphormistpersonificationrootssandystephanie
Load
porter Monday Jun 14, 2021
ashamedawakebeneathbracesbraindieasedisplayfeastgreetniecepraisereleaseremainrepeatsheepishsleevestrayswaythieftraining
Load
Mandy Murphy Monday Jun 14, 2021 Review Test spec and dict
contradictdictatorsindictmentinspectorpredictrespectspectaclesspectatorsspeculateverdict
Load
Mandy Murphy Monday Jun 14, 2021 dict = speck
contradictdictationdictatordictiondictionarydictumedictindictmentpredictverdict
Load
Mandy Murphy Monday Jun 14, 2021 spec = see, look
circumspectinspectintrospectionperspectiverespectretrospectivespectaclespectaclesspectatorspeculate
Load
Mandy Murphy Monday Jun 14, 2021 Review Test ped man and manu
emancipationimpedimentsmanagermaneuvermanipulatemanufacturemanuscriptspeddlerpedestrianquadrupeds
Load
Mandy Murphy Monday Jun 14, 2021 man, manu = hand
emancipatemanaclesmanagermandatemaneuvermanicuremanipulatemanualmanufacturemanuscript
Load
Mandy Murphy Monday Jun 14, 2021 Ped = Foot
bipedcentipedeimpedimentmillipedepedalpeddlerpedestrianpedicurequadrupedtripod
Load
victoria Monday Jun 14, 2021
bookfoodfootgoodlookmoonnoonpooltookzoo
Load
unit 5 week 3
Ms Moya Monday Jun 14, 2021
CharismaCollusionReciprocal assimilate coalesce complementcomplicity complimentconsonantcovenantreciprocate
Load
abw Monday Jun 14, 2021 5.5 Words /i/
Mexicoabilityanimalcandidatecapitalcavitycomplicatecomplimentcontinentdifficultdignityestimatehesitatehospitalindicatelatitudemaximizepositivepracticalsensitivesubstitute
Load
Wilson 5.5 words
Paula Morrissey Monday Jun 14, 2021
AlamoCentral ParkCharging Bull StatueDr. Martin Luther King, Jr. MemorialEmpire State BuildingEvergladesGateway ArchGolden Gate BridgeGrand CanyonHollywood SignLiberty BellLincoln MemorialMount RushmoreNational MallPentagonRT Sixty SixSears TowerSpace NeedleStatue of LibertyWhite House
Load
Teresa Allan Monday Jun 14, 2021 June 15 - Spelling
circumflexdeflectflexibleflexorfractalsfractionfracturefragilefragmentfragmentedfrailinflectioninflexibleinfractionreflectreflectionreflex anglerefractretroflexsuffrage
Load
Monday Jun 14, 2021
autoawakebandagecabbagechanging choicecouldeveryonefourteenfrozegrimierlivliestmergermessageoceanointmentpoisionproceedslighterspiciersqueezesurprising
Load
Irene Mitchell Monday Jun 14, 2021 Spelling #4
accomplishblockboastcoastfellowglobehostknownlocateoatmealoddonlineremotescoldshockshownslopesolvestockthroatwrote
Load
Stephanie Ortiz Monday Jun 14, 2021
SandyStephaniefree versegobbleimageryindividualitymetaphormistpersonificationroots
Load
Mary McKinney Monday Jun 14, 2021 Sort #26
anythingbesidecheckoutherselfitselfmyselfnothingoutfieldoutifitoutsidesidewayssomehowsomeonesomethingsometimesomewherethemselvesthroughoutyourself
Load
CommonCoreSheets Fan Monday Jun 14, 2021
ArabicEnglishdancedrinkeatlessonnotebookpencilplayread
Load
Sara Hunter Monday Jun 14, 2021
axiscoordinatedenominatorequationequationequivalentevaluateexpressionfractiongraphgridintersectintervalmultiplenegativenumeratororderedpairoriginplotpointpositivequadrantrationalreducesimplify
Load
Monday Jun 14, 2021
accidentallybeginningbeginningcontrollinggoverningoccassionallyreferredtotallytransferredvisited
Load
Philip review 2 Monday Jun 14, 2021
believebroughtdoeseverywherehappeninghippopotamuspolygonquadrialteralreachedstoodsurprisethroughtoughweatherwhichwhilewholewouldn't
Load
Ibrahim Al-zrouf Monday Jun 14, 2021
additionalgebraanglesattributesdecimalsdegreesdivisionfractions geometrymathmultiplicationshapessubtraction
Load
CommonCoreSheets Fan Monday Jun 14, 2021
bugdughugjuglugmugpugrugsnugtug
Load
Brittney Wixon Monday Jun 14, 2021
CeilingCinnamonCommercialCommitteeCommunicateDescribedDetermineDisappointedEvidentlyExcitement
Load
Genell Bradley Monday Jun 14, 2021
AgreementElectricEssentialHybridMoving UpRisk takeradvantagescentral Ideacoalcouragesenergygasinfluencersmathematicsnatural gasnuclearoilopen mindedprincipledreadingreflectiverenewablesciencesocial studiestechnology
Load
Genell Bradley Monday Jun 14, 2021
AgreementElectricEssentialHybridMoving UpRisk takeradvantagescentral Ideacoalcouragesenergygasinfluencersmathematicsnatural gasnuclearoilopen mindedprincipledreadingreflectiverenewablesciencesocial studiestechnology
Load
Genell Bradley Monday Jun 14, 2021
AgreementElectricEssentialHybridMoving UpRisk takeradvantagescentral Ideacoalcouragesenergygasinfluencersmathematicsnatural gasnuclearoilopen mindedprincipledreadingreflectiverenewablesciencesocial studiestechnology
Load
Genell Bradley Monday Jun 14, 2021
AgreementElectricEssentialHybridMoving UpRisk takeradvantagescentral Ideacoalcouragesenergygasinfluencersmathematicsnatural gasnuclearoilopen mindedprincipledreadingreflectiverenewablesciencesocial studiestechnology
Load
Mr. J Monday Jun 14, 2021
be a tencoach edo the right thingdr eddingsdr hilleyes on the targetgoalsgreen lightits what you do nextjonesleadersmcilwainmhemiddletonpeople matterredremember who you arerichardsonrobertsschulzseven habitswalk awaywhitework your planyou got this
Load
Sara Hunter Monday Jun 14, 2021
areadecimaldividenddivisorequationequivalentexponentexpressionfactorformulafractionmaximumminimummultiplenegativeperimeterpositivepoweroftenproductquotientroundsumtermunitwholenumber
Load
melissa motola Monday Jun 14, 2021
beforebrushbunchchasedishgreatmathpatchphonethankwhatwhen
Load
CommonCoreSheets Fan Monday Jun 14, 2021 4th Grade Math Review
addendadditionarithmeticdifferencedivisionfactorsmultiplicationproductquotientsubtractionsum
Load
CommonCoreSheets Fan Monday Jun 14, 2021
excludeexitexpensiveexploreexpressextendextrapostdatepostgraduatepostponepostscriptprecautionprefixprehistoricprepay
Load
Cyndy Monday Jun 14, 2021 Vocabulary Review 2
berserkbittercapablecolossalcomplexcoordinatedcumbersomedrearyelegantfaultyfragilefrailgrumpyhesitateimmenselylackedlivelymodernnumerousobsoleteoutgoingsteepsturdytiresomewretched
Load
Vocab Review 2
Monday Jun 14, 2021 /ue/ Sound Pattern
accuseamusementarguebugleconfusecontinuecubicalfuminghueimpossibleissuejournalmuteoccupyperfumerescueuniformunifyusefulutensils
Load
Monday Jun 14, 2021 14th June
awfulbetweenchocolateeatjuicymanymealsneverspoontasty
Load
fRANCISCO Sunday Jun 13, 2021 MID-YEAR REVISION
abilityanxiousattractiveboisterouscricketerenemyentertainentrancefashionfavouritegeneralgrandparentshappilyhighwayinsectobedientpeculiarploughregionsentenceshowerthemselvestreasurevegetablesweekend
Load
Francisco Sunday Jun 13, 2021
Januaryceilingdaffodildeliciousedibleeducationenthusiasmevidenceexceptionexteriorgaolgenerousinitialsinstrumentlandscapemiscellaneousoccasionallyprincipalrecipesecretarysievestationerystrengthensufficientundulating
Load
Nielsen Sunday Jun 13, 2021 Summer School Vocabulary
bouncecapturecluecollardamagedisappearfossilhelmethockeyhurriedinvitedlumbermedalmiddlenoisierridgeserveshownskippingsquarestripedsuitthirsttracedwrinkle
Load
CommonCoreSheets Fan Sunday Jun 13, 2021 oo sound
bruisecouponcruisefruitgroupjuicerecruitsoupsuitcasetoucanwoundyouth
Load
Mrs. M. Sunday Jun 13, 2021
achieveagreeapronauthorbracketbucketbushelchickenclothingdeclaredegreegathermachineposterratherrocketsecretticketwhetherwhiskers
Load
Davidwilson Sunday Jun 13, 2021
bandbluegrandhandhearherelittlepinktheir there
Load
Beatriz Sunday Jun 13, 2021
Podunkabominablyagendabandanabinocularsbizarrobriberycuratordim sumdoldrumsduvetexplosivefacultyfull-fledgedglucosehazelnutiotakosherlexiconmeagerquibblerelativesirlointopiaryvehicular
Load
Stephanie Ortiz Sunday Jun 13, 2021 Unit 6.5 Vocabulary
SandyStephaniefree versegobbleimageryindividualitymetaphormistpersonificationroots
Load
Stephanie Ortiz Sunday Jun 13, 2021
SandyStephaniefree versegobbleimageryindividualitymetaphormistpersonificationroots
Load
Advertisement: